PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_573ABF1D7.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 239aa    MW: 26047.4 Da    PI: 6.4042
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_573ABF1D7.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-10112157550
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                            kr +r   NR +A+rsR RK+++i eLe+ v  L+ e +aL  ++ 
  Traes_5BL_573ABF1D7.1 112 KRVKRILANRQSAQRSRVRKLQYISELERSVTGLQMEVSALSPRVA 157
                            8999*******************************99999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-11108172IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.461110166IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-11112166No hitNo description
PfamPF001702.6E-9112160IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-13112166No hitNo description
CDDcd147032.38E-22113163No hitNo description
PROSITE patternPS000360115130IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAQLPPRAPS AGEQDWPVAG EFLGFAAARR GVHRRSASDP AAFLEAVPMD HILSGGGGDD  60
EFDRLDDEQL MSMFSNVDGG CDRPGFMDTG EAEEGAASAG AMTAADGFGD PKRVKRILAN  120
RQSAQRSRVR KLQYISELER SVTGLQMEVS ALSPRVAFLD HQRSLLTVGN SHLRQRIAAL  180
AQDKIFKDAH QEALKEEIER LRQLFHHQKI KATGGTDMAT AASMQAKQEL LMCEGAAMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572005.11e-125PREDICTED: basic leucine zipper 19
SwissprotQ6K3R96e-97BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLW5FBP11e-175W5FBP1_WHEAT; Uncharacterized protein
STRINGMLOC_39203.11e-160(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.15e-55bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]